![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (8 families) ![]() |
![]() | Family c.23.5.1: Flavodoxin-related [52219] (5 proteins) binds FMN |
![]() | Protein Flavodoxin [52220] (9 species) |
![]() | Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (7 PDB entries) |
![]() | Domain d1dx9b_: 1dx9 B: [31172] apo form |
PDB Entry: 1dx9 (more details), 2.05 Å
SCOP Domain Sequences for d1dx9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dx9b_ c.23.5.1 (B:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]} kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanige lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
Timeline for d1dx9b_: