Lineage for d1dx9b_ (1dx9 B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825904Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 825905Family c.23.5.1: Flavodoxin-related [52219] (5 proteins)
    binds FMN
  6. 825906Protein Flavodoxin [52220] (9 species)
  7. 825907Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (7 PDB entries)
  8. 825912Domain d1dx9b_: 1dx9 B: [31172]
    apo form

Details for d1dx9b_

PDB Entry: 1dx9 (more details), 2.05 Å

PDB Description: w57a apoflavodoxin from anabaena
PDB Compounds: (B:) flavodoxin

SCOP Domain Sequences for d1dx9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dx9b_ c.23.5.1 (B:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOP Domain Coordinates for d1dx9b_:

Click to download the PDB-style file with coordinates for d1dx9b_.
(The format of our PDB-style files is described here.)

Timeline for d1dx9b_: