Lineage for d1dx9a_ (1dx9 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1587349Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1587350Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1587351Protein Flavodoxin [52220] (9 species)
  7. 1587352Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (8 PDB entries)
  8. 1587358Domain d1dx9a_: 1dx9 A: [31171]
    apo form
    complexed with so4

Details for d1dx9a_

PDB Entry: 1dx9 (more details), 2.05 Å

PDB Description: w57a apoflavodoxin from anabaena
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1dx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dx9a_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOPe Domain Coordinates for d1dx9a_:

Click to download the PDB-style file with coordinates for d1dx9a_.
(The format of our PDB-style files is described here.)

Timeline for d1dx9a_: