Lineage for d4ww2b1 (4ww2 B:0-125)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756669Domain d4ww2b1: 4ww2 B:0-125 [311706]
    Other proteins in same PDB: d4ww2a2, d4ww2c1, d4ww2f_
    automated match to d3q5ya1
    complexed with jls, nag

Details for d4ww2b1

PDB Entry: 4ww2 (more details), 2.48 Å

PDB Description: crystal structure of human tcr alpha chain-trav21-traj8, beta chain- trbv7-8, antigen-presenting glycoprotein cd1d, and beta-2- microglobulin
PDB Compounds: (B:) TCR Beta Chain-TRBV7-8

SCOPe Domain Sequences for d4ww2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ww2b1 b.1.1.0 (B:0-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgagvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksg
lpsdrffaerpegsvstlkiqrtqqedsavylcasssrdleqyfgpgtrltvte

SCOPe Domain Coordinates for d4ww2b1:

Click to download the PDB-style file with coordinates for d4ww2b1.
(The format of our PDB-style files is described here.)

Timeline for d4ww2b1: