Lineage for d4xsqb1 (4xsq B:21-199)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435068Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2435137Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2435341Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2435342Protein automated matches [190787] (12 species)
    not a true protein
  7. 2435343Species Branchiostoma floridae [TaxId:7739] [311702] (1 PDB entry)
  8. 2435345Domain d4xsqb1: 4xsq B:21-199 [311703]
    Other proteins in same PDB: d4xsqb2
    automated match to d1w8aa_
    complexed with edo, gol

Details for d4xsqb1

PDB Entry: 4xsq (more details), 1.79 Å

PDB Description: structure of a variable lymphocyte receptor-like protein bf66946 from branchiostoma floridae
PDB Compounds: (B:) variable lymphocyte receptor-like protein Bf66946

SCOPe Domain Sequences for d4xsqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xsqb1 c.10.2.0 (B:21-199) automated matches {Branchiostoma floridae [TaxId: 7739]}
cpsackctvslygemvvacggmglteipediphravylvlkdnnitkitsysfkglrnlq
gidlsnnkinhissaalrhlghlddidlsrneltsvseklfdfpissakaqgrrffvyla
nnpwgcdcrmawlaqelaggsktfgdrhmecatpaalagrglseipqtsfvctgrdisf

SCOPe Domain Coordinates for d4xsqb1:

Click to download the PDB-style file with coordinates for d4xsqb1.
(The format of our PDB-style files is described here.)

Timeline for d4xsqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xsqb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4xsqa_