SCOP 1.73: Domain d1rcfa_: 1rcf A:

Lineage for d1rcfa_ (1rcf A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (8 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (5 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (9 species)

7. Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (7 PDB entries)

8. Domain d1rcfa_: 1rcf A: [31170]
   complexed with fmn, so4

Details for d1rcfa_

PDB Entry: 1rcf, 1.4 Å

PDB Description: structure of the trigonal form of recombinant oxidized flavodoxin from anabaena 7120 at 1.40 angstroms resolution

PDB Compounds: (A:) flavodoxin

SCOP Domain Sequences for d1rcfa_:

Sequence; same for both SEQRES and ATOM records:

>d1rcfa_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]}
skkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

Timeline for d1rcfa_:

• d1rcfa_ first appeared (with stable ids) in SCOP 1.55, called d1rcf__
  
• d1rcfa_ was called d1rcf__ in SCOP 1.71
  
• d1rcfa_ appears in SCOP 1.75
  
• d1rcfa_ appears in the current release, SCOPe 2.08