Lineage for d1rcf__ (1rcf -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (6 species) 
Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (5 PDB entries) 
Domain d1rcf__: 1rcf - [31170]
Details for d1rcf__
PDB Entry: 1rcf (more details), 1.4 Å
PDB Description: structure of the trigonal form of recombinant oxidized flavodoxin from anabaena 7120 at 1.40 angstroms resolution
SCOP Domain Sequences for d1rcf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rcf__ c.23.5.1 (-) Flavodoxin {Anabaena, pcc 7119 and 7120}
skkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
SCOP Domain Coordinates for d1rcf__:
Click to download the PDB-style file with coordinates for d1rcf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rcf__:
- d1rcf__ first appeared (with stable ids) in SCOP 1.55
- d1rcf__ appears in SCOP 1.59
- d1rcf__ appears in the current release, SCOPe 2.08, called d1rcfa_
View in 3D