SCOPe 2.08: Domain d4xo9a1: 4xo9 A:1-158

Lineage for d4xo9a1 (4xo9 A:1-158)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein Mannose-specific adhesin FimH, N-terminal domain [418900] (2 species)
   protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:83333] [419302] (26 PDB entries)

8. Domain d4xo9a1: 4xo9 A:1-158 [311695]
   Other proteins in same PDB: d4xo9a2
   automated match to d1klfb1

Details for d4xo9a1

PDB Entry: 4xo9, 1.14 Å

PDB Description: crystal structure of a fimh*dsg complex from e.coli k12 in space group c2

PDB Compounds: (A:) protein fimh

SCOPe Domain Sequences for d4xo9a1:

Sequence; same for both SEQRES and ATOM records:

>d4xo9a1 b.2.3.2 (A:1-158) Mannose-specific adhesin FimH, N-terminal domain {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d4xo9a1:

• d4xo9a1 first appeared in SCOPe 2.06
  
• d4xo9a1 appears in SCOPe 2.07