| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [225474] (6 PDB entries) |
| Domain d2myga1: 2myg A:3-97 [311693] Other proteins in same PDB: d2myga2 automated match to d3rhba_ |
PDB Entry: 2myg (more details)
SCOPe Domain Sequences for d2myga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2myga1 c.47.1.0 (A:3-97) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mpsiasmikgnkvvvfswvtcpycvraekllhartkditvhyvdkmsegeqlrgeiyqay
khetvpaifingnfiggcsdlealdkegkldglls
Timeline for d2myga1: