SCOPe 2.08: Domain d2myga1: 2myg A:3-97

Lineage for d2myga1 (2myg A:3-97)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [225474] (6 PDB entries)

8. Domain d2myga1: 2myg A:3-97 [311693]
   Other proteins in same PDB: d2myga2
   automated match to d3rhba_

Details for d2myga1

PDB Entry: 2myg

PDB Description: solution structure of the dithiolic glutaredoxin 2-c-grx1 from the pathogen trypanosoma brucei brucei

PDB Compounds: (A:) Dithiol glutaredoxin 1

SCOPe Domain Sequences for d2myga1:

Sequence; same for both SEQRES and ATOM records:

>d2myga1 c.47.1.0 (A:3-97) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mpsiasmikgnkvvvfswvtcpycvraekllhartkditvhyvdkmsegeqlrgeiyqay
khetvpaifingnfiggcsdlealdkegkldglls

Timeline for d2myga1:

• d2myga1 first appeared in SCOPe 2.06
  
• d2myga1 appears in SCOPe 2.07