Lineage for d4r06a_ (4r06 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (167 PDB entries)
  8. 2336360Domain d4r06a_: 4r06 A: [311689]
    automated match to d3prga_
    complexed with 3e7, so4

Details for d4r06a_

PDB Entry: 4r06 (more details), 2.22 Å

PDB Description: crystal structure of sr2067 bound to ppargamma
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d4r06a_:

Sequence, based on SEQRES records: (download)

>d4r06a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
vtehvqllqvikktetdmslhpllqeiykd

Sequence, based on observed residues (ATOM records): (download)

>d4r06a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pesadlralakhlydsyiksfpltkakarailtttdkspfviydmnslmmgeevairifq
gcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlise
gqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnv
kpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdm
slhpllqeiykd

SCOPe Domain Coordinates for d4r06a_:

Click to download the PDB-style file with coordinates for d4r06a_.
(The format of our PDB-style files is described here.)

Timeline for d4r06a_: