![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) ![]() automatically mapped to Pfam PF00591 |
![]() | Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins) |
![]() | Protein automated matches [254642] (4 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:90371] [311684] (2 PDB entries) |
![]() | Domain d4xr5b2: 4xr5 B:71-335 [311685] Other proteins in same PDB: d4xr5a1, d4xr5a3, d4xr5b1, d4xr5b3 automated match to d4x46b2 complexed with cl, peg, pge |
PDB Entry: 4xr5 (more details), 2.05 Å
SCOPe Domain Sequences for d4xr5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xr5b2 c.27.1.1 (B:71-335) automated matches {Salmonella enterica [TaxId: 90371]} dwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglghtggtldkleai pgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsiplitgsilak klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa gnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearaklqavldngkaa evfgrmvaaqkgpsdfvenydkylp
Timeline for d4xr5b2: