Lineage for d4xr5b2 (4xr5 B:71-335)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861697Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2861698Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2861699Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins)
  6. 2861758Protein automated matches [254642] (4 species)
    not a true protein
  7. 2861766Species Salmonella enterica [TaxId:90371] [311684] (2 PDB entries)
  8. 2861768Domain d4xr5b2: 4xr5 B:71-335 [311685]
    Other proteins in same PDB: d4xr5a1, d4xr5a3, d4xr5b1, d4xr5b3
    automated match to d4x46b2
    complexed with cl, peg, pge

Details for d4xr5b2

PDB Entry: 4xr5 (more details), 2.05 Å

PDB Description: x-ray structure of the unliganded thymidine phosphorylase from salmonella typhimurium at 2.05 a resolution
PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d4xr5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xr5b2 c.27.1.1 (B:71-335) automated matches {Salmonella enterica [TaxId: 90371]}
dwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglghtggtldkleai
pgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsiplitgsilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearaklqavldngkaa
evfgrmvaaqkgpsdfvenydkylp

SCOPe Domain Coordinates for d4xr5b2:

Click to download the PDB-style file with coordinates for d4xr5b2.
(The format of our PDB-style files is described here.)

Timeline for d4xr5b2: