| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
| Family a.46.2.0: automated matches [254276] (1 protein) not a true family |
| Protein automated matches [254641] (5 species) not a true protein |
| Species Salmonella enterica [TaxId:90371] [311682] (2 PDB entries) |
| Domain d4xr5b1: 4xr5 B:1-70 [311683] Other proteins in same PDB: d4xr5a2, d4xr5a3, d4xr5b2, d4xr5b3 automated match to d4x46b1 complexed with cl, peg, pge |
PDB Entry: 4xr5 (more details), 2.05 Å
SCOPe Domain Sequences for d4xr5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xr5b1 a.46.2.0 (B:1-70) automated matches {Salmonella enterica [TaxId: 90371]}
mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl
Timeline for d4xr5b1: