Lineage for d4xr5b1 (4xr5 B:1-70)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714352Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2714363Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2714423Family a.46.2.0: automated matches [254276] (1 protein)
    not a true family
  6. 2714424Protein automated matches [254641] (6 species)
    not a true protein
  7. 2714437Species Salmonella enterica [TaxId:90371] [311682] (2 PDB entries)
  8. 2714439Domain d4xr5b1: 4xr5 B:1-70 [311683]
    Other proteins in same PDB: d4xr5a2, d4xr5a3, d4xr5b2, d4xr5b3
    automated match to d4x46b1
    complexed with cl, peg, pge

Details for d4xr5b1

PDB Entry: 4xr5 (more details), 2.05 Å

PDB Description: x-ray structure of the unliganded thymidine phosphorylase from salmonella typhimurium at 2.05 a resolution
PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d4xr5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xr5b1 a.46.2.0 (B:1-70) automated matches {Salmonella enterica [TaxId: 90371]}
mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl

SCOPe Domain Coordinates for d4xr5b1:

Click to download the PDB-style file with coordinates for d4xr5b1.
(The format of our PDB-style files is described here.)

Timeline for d4xr5b1: