SCOPe 2.08: Domain d4xr5b1: 4xr5 B:1-70

Lineage for d4xr5b1 (4xr5 B:1-70)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.0: automated matches [254276] (1 protein)
   not a true family

6. Protein automated matches [254641] (6 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [311682] (2 PDB entries)

8. Domain d4xr5b1: 4xr5 B:1-70 [311683]
   Other proteins in same PDB: d4xr5a2, d4xr5a3, d4xr5b2, d4xr5b3
   automated match to d4x46b1
   complexed with cl, peg, pge

Details for d4xr5b1

PDB Entry: 4xr5, 2.05 Å

PDB Description: x-ray structure of the unliganded thymidine phosphorylase from salmonella typhimurium at 2.05 a resolution

PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d4xr5b1:

Sequence; same for both SEQRES and ATOM records:

>d4xr5b1 a.46.2.0 (B:1-70) automated matches {Salmonella enterica [TaxId: 90371]}
mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl

Timeline for d4xr5b1:

• d4xr5b1 first appeared in SCOPe 2.06
  
• d4xr5b1 appears in SCOPe 2.07