SCOPe 2.06: Domain d4x57a1: 4x57 A:1-147

Lineage for d4x57a1 (4x57 A:1-147)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.0: automated matches [191322] (1 protein)
   not a true family

6. Protein automated matches [190120] (8 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [311631] (1 PDB entry)

8. Domain d4x57a1: 4x57 A:1-147 [311677]
   Other proteins in same PDB: d4x57a2, d4x57b_, d4x57c2, d4x57d_
   automated match to d2c2vb_
   complexed with so4

Details for d4x57a1

PDB Entry: 4x57, 2.8 Å

PDB Description: structure of an arabidopsis e2 / membrane-anchored ubiquitin-fold protein complex

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 8

SCOPe Domain Sequences for d4x57a1:

Sequence; same for both SEQRES and ATOM records:

>d4x57a1 d.20.1.0 (A:1-147) automated matches {Arabidopsis thaliana [TaxId: 3702]}
maskrilkelkdlqkdpptscsagpvaedmfhwqatimgpaespysggvflvtihfppdy
pfkppkvafrtkvfhpninsngsicldilkeqwspaltiskvllsicslltdpnpddplv
peiahmyktdrakyeatarnwtqkyam

Timeline for d4x57a1:

• d4x57a1 is new in SCOPe 2.06-stable
  
• d4x57a1 appears in SCOPe 2.07
  
• d4x57a1 appears in the current release, SCOPe 2.08