| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
| Protein automated matches [190569] (9 species) not a true protein |
| Species Escherichia coli [TaxId:362663] [311670] (2 PDB entries) |
| Domain d4xoca_: 4xoc A: [311671] automated match to d4csta_ complexed with kgm |
PDB Entry: 4xoc (more details), 1.42 Å
SCOPe Domain Sequences for d4xoca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xoca_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 362663]}
facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d4xoca_: