Lineage for d1c7ea_ (1c7e A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825904Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 825905Family c.23.5.1: Flavodoxin-related [52219] (5 proteins)
    binds FMN
  6. 825906Protein Flavodoxin [52220] (9 species)
  7. 825941Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
    Uniprot P00323
  8. 825967Domain d1c7ea_: 1c7e A: [31167]

Details for d1c7ea_

PDB Entry: 1c7e (more details), 2.25 Å

PDB Description: d95e hydroquinone flavodoxin mutant from d. vulgaris
PDB Compounds: (A:) flavodoxin

SCOP Domain Sequences for d1c7ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ea_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgessyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOP Domain Coordinates for d1c7ea_:

Click to download the PDB-style file with coordinates for d1c7ea_.
(The format of our PDB-style files is described here.)

Timeline for d1c7ea_: