SCOPe 2.07: Domain d4xcnb2: 4xcn B:107-213

Lineage for d4xcnb2 (4xcn B:107-213)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d4xcnb2: 4xcn B:107-213 [311657]
Other proteins in same PDB: d4xcnb1, d4xcnd1, d4xcnf1, d4xcni1, d4xcnk1, d4xcnl1
automated match to d1dn0a2
complexed with 44e, gol, po4, unl

Details for d4xcnb2

PDB Entry: 4xcn (more details), 2.9 Å

PDB Description: crystal structure of human 4e10 fab in complex with phosphatidic acid (06:0 pa); 2.9 a resolution

PDB Compounds: (B:) 4E10 Fab light chain

SCOPe Domain Sequences for d4xcnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xcnb2 b.1.1.2 (B:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d4xcnb2:

Click to download the PDB-style file with coordinates for d4xcnb2.
(The format of our PDB-style files is described here.)

Timeline for d4xcnb2: