Lineage for d4xcnb1 (4xcn B:1-106)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (22 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries) 
Domain d4xcnb1: 4xcn B:1-106 [311656]
Other proteins in same PDB: d4xcnb2, d4xcnd2, d4xcnf2, d4xcni2, d4xcnk2, d4xcnl2
automated match to d1dn0a1
complexed with 44e, gol, po4, unl
Details for d4xcnb1
PDB Entry: 4xcn (more details), 2.9 Å
PDB Description: crystal structure of human 4e10 fab in complex with phosphatidic acid (06:0 pa); 2.9 a resolution
PDB Compounds: (B:) 4E10 Fab light chainSCOPe Domain Sequences for d4xcnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xcnb1 b.1.1.1 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev
SCOPe Domain Coordinates for d4xcnb1:
Click to download the PDB-style file with coordinates for d4xcnb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4xcnb1:
View in 3D
