| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
| Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins) contains irregular array of helices in the N-terminal extension automatically mapped to Pfam PF02211 |
| Protein Iron-containing nitrile hydratase [50102] (1 species) |
| Species Rhodococcus erythropolis [TaxId:1833] [50103] (28 PDB entries) also Rhodococcus sp. R312 |
| Domain d3x26b_: 3x26 B: [311655] Other proteins in same PDB: d3x26a_ automated match to d3wveb_ complexed with cl, fe, mg, tan; mutant |
PDB Entry: 3x26 (more details), 1.34 Å
SCOPe Domain Sequences for d3x26b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x26b_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevkyvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepaa
Timeline for d3x26b_: