Lineage for d4xoac2 (4xoa C:159-279)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767464Protein Mannose-specific adhesin FimH, C-terminal domain [418901] (2 species)
    protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2767491Species Escherichia coli [TaxId:83333] [419303] (2 PDB entries)
  8. 2767494Domain d4xoac2: 4xoa C:159-279 [311654]
    Other proteins in same PDB: d4xoaa1, d4xoac1, d4xoae1, d4xoag1
    automated match to d1klfb2
    missing some secondary structures that made up less than one-third of the common domain

Details for d4xoac2

PDB Entry: 4xoa (more details), 2.54 Å

PDB Description: crystal structure of a fimh*dsg complex from e.coli k12 in space group p1
PDB Compounds: (C:) protein fimh

SCOPe Domain Sequences for d4xoac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xoac2 b.2.3.2 (C:159-279) Mannose-specific adhesin FimH, C-terminal domain {Escherichia coli [TaxId: 83333]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

SCOPe Domain Coordinates for d4xoac2:

Click to download the PDB-style file with coordinates for d4xoac2.
(The format of our PDB-style files is described here.)

Timeline for d4xoac2: