SCOPe 2.08: Domain d4xoaa2: 4xoa A:159-279

Lineage for d4xoaa2 (4xoa A:159-279)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein Mannose-specific adhesin FimH, C-terminal domain [418901] (2 species)
   protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:83333] [419303] (2 PDB entries)

8. Domain d4xoaa2: 4xoa A:159-279 [311652]
   Other proteins in same PDB: d4xoaa1, d4xoac1, d4xoae1, d4xoag1
   automated match to d1klfb2
   missing some secondary structures that made up less than one-third of the common domain

Details for d4xoaa2

PDB Entry: 4xoa, 2.54 Å

PDB Description: crystal structure of a fimh*dsg complex from e.coli k12 in space group p1

PDB Compounds: (A:) protein fimh

SCOPe Domain Sequences for d4xoaa2:

Sequence; same for both SEQRES and ATOM records:

>d4xoaa2 b.2.3.2 (A:159-279) Mannose-specific adhesin FimH, C-terminal domain {Escherichia coli [TaxId: 83333]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

Timeline for d4xoaa2:

• d4xoaa2 first appeared in SCOPe 2.06
  
• d4xoaa2 appears in SCOPe 2.07