Lineage for d4xnnb_ (4xnn B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375262Species Daphnia pulex [TaxId:6669] [311638] (12 PDB entries)
  8. 2375264Domain d4xnnb_: 4xnn B: [311639]
    automated match to d4csib_
    complexed with gol

Details for d4xnnb_

PDB Entry: 4xnn (more details), 1.9 Å

PDB Description: crystal structure of a gh7 family cellobiohydrolase from daphnia pulex
PDB Compounds: (B:) Cellobiohydrolase CHBI

SCOPe Domain Sequences for d4xnnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xnnb_ b.29.1.0 (B:) automated matches {Daphnia pulex [TaxId: 6669]}
envgtqaaeeplnlpisvctapgncqteadavvldsnwrwahtttgytncytgnlwdttl
cptpetcttncaidgvpladwsgtyggsvtgnkfnlkfvtvgpystnigartflldstkt
ryrmfqllnreftydvdvssldcglngalyfvsmdadggaakyptnkggakygtgycdaq
cphdvkwinglanskdwtpipgdansgkgyygnccaeldiweankqsqaftthpctpndq
trcegvvcgdndsgdryngmcdkdgcdfasyrmndhtfygpgstfkldstkpftvvsqfi
ttdgtdngdfkefrrfyvqngvrienskvnfpgitaydsitdemcaatkglfgdlddhkn
kggmkqmgeamrkgmalvmsiwddhdvnmlwldsnypptgnpstpgvargpcpttsgvps
evevtqanavvsfgnikfgpigstv

SCOPe Domain Coordinates for d4xnnb_:

Click to download the PDB-style file with coordinates for d4xnnb_.
(The format of our PDB-style files is described here.)

Timeline for d4xnnb_: