| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
| Protein automated matches [190120] (8 species) not a true protein |
| Species Arabidopsis thaliana [TaxId:3702] [311631] (1 PDB entry) |
| Domain d4x57c1: 4x57 C:1-148 [311632] Other proteins in same PDB: d4x57a2, d4x57b_, d4x57c2, d4x57d_ automated match to d2c2vb_ complexed with so4 |
PDB Entry: 4x57 (more details), 2.8 Å
SCOPe Domain Sequences for d4x57c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x57c1 d.20.1.0 (C:1-148) automated matches {Arabidopsis thaliana [TaxId: 3702]}
maskrilkelkdlqkdpptscsagpvaedmfhwqatimgpaespysggvflvtihfppdy
pfkppkvafrtkvfhpninsngsicldilkeqwspaltiskvllsicslltdpnpddplv
peiahmyktdrakyeatarnwtqkyamg
Timeline for d4x57c1:
View in 3DDomains from other chains: (mouse over for more information) d4x57a1, d4x57a2, d4x57b_, d4x57d_ |