Lineage for d4pixa_ (4pix A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080777Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 2080778Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 2080786Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (51 PDB entries)
  8. 2080807Domain d4pixa_: 4pix A: [311630]
    automated match to d4ubga_
    complexed with cl, fe

Details for d4pixa_

PDB Entry: 4pix (more details), 1.35 Å

PDB Description: unliganded cysteine dioxygenase c93a variant at ph 6.2
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d4pixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pixa_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshaflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOPe Domain Coordinates for d4pixa_:

Click to download the PDB-style file with coordinates for d4pixa_.
(The format of our PDB-style files is described here.)

Timeline for d4pixa_: