Lineage for d4d5fa2 (4d5f A:68-206)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2728262Family a.121.1.0: automated matches [227226] (1 protein)
    not a true family
  6. 2728263Protein automated matches [226967] (6 species)
    not a true protein
  7. 2728278Species Mannheimia haemolytica [TaxId:75985] [311626] (1 PDB entry)
  8. 2728279Domain d4d5fa2: 4d5f A:68-206 [311627]
    Other proteins in same PDB: d4d5fa1
    automated match to d2vpra2
    complexed with cl, gol, so4

Details for d4d5fa2

PDB Entry: 4d5f (more details), 2.2 Å

PDB Description: tetracycline repressor class h, apo form
PDB Compounds: (A:) tetracycline resistance repressor protein

SCOPe Domain Sequences for d4d5fa2:

Sequence, based on SEQRES records: (download)

>d4d5fa2 a.121.1.0 (A:68-206) automated matches {Mannheimia haemolytica [TaxId: 75985]}
lplpnetwqdflrnnaksfrqallmyrdggkihagtrpsesqfetseqqlqflcdagfsl
sqavyalssiahftlgsvletqehqesqkerekvetdtvaypplltqavaimdsdngdaa
flfvldvmisgletvlksa

Sequence, based on observed residues (ATOM records): (download)

>d4d5fa2 a.121.1.0 (A:68-206) automated matches {Mannheimia haemolytica [TaxId: 75985]}
lplpnetwqdflrnnaksfrqallmyrdggkihagtrpsesqfetseqqlqflcdagfsl
sqavyalssiahftlgsvletqehqesqkeaypplltqavaimdsdngdaaflfvldvmi
sgletvlksa

SCOPe Domain Coordinates for d4d5fa2:

Click to download the PDB-style file with coordinates for d4d5fa2.
(The format of our PDB-style files is described here.)

Timeline for d4d5fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4d5fa1