Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d1akva_ (1akv A:)

  1. Root: SCOP 1.75
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. Family c.23.5.1: Flavodoxin-related [52219] (5 protein domains)
    binds FMN
  6. Protein Flavodoxin [52220] (9 species)
  7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
    Uniprot P00323
  8. Domain d1akva_: 1akv A: [31162]
    complexed with fmn, so4; mutant

Details for d1akva_

PDB Entry: 1akv (more details)
PDB Description: d95a semiquinone flavodoxin mutant from d. vulgaris
PDB Compounds: (A:) flavodoxin

SCOP Domain Sequences for d1akva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akva_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgassyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOP Domain Coordinates for d1akva_:

Click to download the PDB-style file with coordinates for d1akva_.
(The format of our PDB-style files is described here.)

Timeline for d1akva_:

d1akva_ appears in SCOP 1.73
d1akva_ appears in SCOP 1.75A


d1akva_
(click for larger image)


d1akva_ in context of chain

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu