Lineage for d1akv__ (1akv -)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (7 families) 
Family c.23.5.1: Flavodoxin-related [52219] (4 proteins)
binds FMNProtein Flavodoxin [52220] (7 species) Species Desulfovibrio vulgaris [TaxId:881] [52222] (20 PDB entries) 
Domain d1akv__: 1akv - [31162]
Details for d1akv__
PDB Entry: 1akv (more details), 2 Å
PDB Description: d95a semiquinone flavodoxin mutant from d. vulgaris
SCOP Domain Sequences for d1akv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1akv__ c.23.5.1 (-) Flavodoxin {Desulfovibrio vulgaris}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgassyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai
SCOP Domain Coordinates for d1akv__:
Click to download the PDB-style file with coordinates for d1akv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1akv__:
- d1akv__ first appeared (with stable ids) in SCOP 1.55
- d1akv__ appears in SCOP 1.67
- d1akv__ appears in SCOP 1.71
- d1akv__ appears in the current release, SCOPe 2.08, called d1akva_
View in 3D