![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (61 species) not a true protein |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [195640] (4 PDB entries) |
![]() | Domain d4v37d_: 4v37 D: [311618] automated match to d4a0ma_ complexed with 0d8, ae3, fmt, k, nad, pg4 |
PDB Entry: 4v37 (more details), 2.1 Å
SCOPe Domain Sequences for d4v37d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v37d_ c.82.1.0 (D:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]} piparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnnw satsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqae aldgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlkp selasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgskv masaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqiasatsrllvhesi aaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsrp ehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaavf sndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqvt qdisdepwgwyks
Timeline for d4v37d_: