![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
![]() | Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [188976] (33 PDB entries) |
![]() | Domain d4xe6x1: 4xe6 X:1-156 [311612] Other proteins in same PDB: d4xe6x2 automated match to d3fywx_ complexed with 06u, act, ndp |
PDB Entry: 4xe6 (more details), 2.69 Å
SCOPe Domain Sequences for d4xe6x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xe6x1 c.71.1.1 (X:1-156) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]} tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd tffppytfedwevassvegkldekntiphtflhlir
Timeline for d4xe6x1: