| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
| Protein Flavodoxin [52220] (10 species) |
| Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries) Uniprot P00323 |
| Domain d1akua_: 1aku A: [31161] complexed with fmn, so4; mutant |
PDB Entry: 1aku (more details), 1.9 Å
SCOPe Domain Sequences for d1akua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1akua_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgassyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai
Timeline for d1akua_: