![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Vatairea macrocarpa [TaxId:77050] [268912] (6 PDB entries) |
![]() | Domain d4wv8c_: 4wv8 C: [311604] automated match to d4u36a_ complexed with ca, mn |
PDB Entry: 4wv8 (more details), 1.83 Å
SCOPe Domain Sequences for d4wv8c_:
Sequence, based on SEQRES records: (download)
>d4wv8c_ b.29.1.0 (C:) automated matches {Vatairea macrocarpa [TaxId: 77050]} msevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiw ddstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiqt vavefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltaslt ypsnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqapsdds n
>d4wv8c_ b.29.1.0 (C:) automated matches {Vatairea macrocarpa [TaxId: 77050]} msevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiw ddstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsiqtvav efdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltasltyps natsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqapsddsn
Timeline for d4wv8c_: