SCOPe 2.03: Domain d3fx2a_: 3fx2 A:

Lineage for d3fx2a_ (3fx2 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (9 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
   Uniprot P00323

8. Domain d3fx2a_: 3fx2 A: [31160]
   complexed with fmn

Details for d3fx2a_

PDB Entry: 3fx2, 1.9 Å

PDB Description: comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d3fx2a_:

Sequence; same for both SEQRES and ATOM records:

>d3fx2a_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

Timeline for d3fx2a_:

• d3fx2a_ first appeared (with stable ids) in SCOP 1.55, called d3fx2__
  
• d3fx2a_ appears in SCOPe 2.02
  
• d3fx2a_ appears in SCOPe 2.04
  
• d3fx2a_ appears in the current release, SCOPe 2.08