Lineage for d3fx2a_ (3fx2 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982673Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 982674Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 982675Protein Flavodoxin [52220] (9 species)
  7. 982711Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
    Uniprot P00323
  8. 982729Domain d3fx2a_: 3fx2 A: [31160]
    complexed with fmn

Details for d3fx2a_

PDB Entry: 3fx2 (more details), 1.9 Å

PDB Description: comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d3fx2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fx2a_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOPe Domain Coordinates for d3fx2a_:

Click to download the PDB-style file with coordinates for d3fx2a_.
(The format of our PDB-style files is described here.)

Timeline for d3fx2a_: