Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (59 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [269137] (14 PDB entries) |
Domain d4s1ob_: 4s1o B: [311597] automated match to d1yula_ complexed with cl, nap |
PDB Entry: 4s1o (more details), 1.84 Å
SCOPe Domain Sequences for d4s1ob_:
Sequence, based on SEQRES records: (download)
>d4s1ob_ c.26.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtvi atasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweel felarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwy lmpdgvvqyvskrrlyt
>d4s1ob_ c.26.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpvsaaehrylmtviatasnp rfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswweelfelarfvg vsrpgaltlveipalaisstdcrqraeqsrplwylmpdgvvqyvskrrlyt
Timeline for d4s1ob_: