Lineage for d4s1ob_ (4s1o B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (52 species)
    not a true protein
  7. 2443350Species Mycobacterium tuberculosis [TaxId:83332] [269137] (4 PDB entries)
  8. 2443354Domain d4s1ob_: 4s1o B: [311597]
    automated match to d1yula_
    complexed with cl, nap

Details for d4s1ob_

PDB Entry: 4s1o (more details), 1.84 Å

PDB Description: structure of mycobacterium tuberculosis nadd in complex with nadp
PDB Compounds: (B:) Probable nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d4s1ob_:

Sequence, based on SEQRES records: (download)

>d4s1ob_ c.26.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtvi
atasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweel
felarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwy
lmpdgvvqyvskrrlyt

Sequence, based on observed residues (ATOM records): (download)

>d4s1ob_ c.26.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpvsaaehrylmtviatasnp
rfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswweelfelarfvg
vsrpgaltlveipalaisstdcrqraeqsrplwylmpdgvvqyvskrrlyt

SCOPe Domain Coordinates for d4s1ob_:

Click to download the PDB-style file with coordinates for d4s1ob_.
(The format of our PDB-style files is described here.)

Timeline for d4s1ob_: