Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries) |
Domain d4xbpd1: 4xbp D:1-106 [311593] Other proteins in same PDB: d4xbpb2, d4xbpd2, d4xbpf2, d4xbpl2 automated match to d1dn0a1 complexed with gol |
PDB Entry: 4xbp (more details), 2.94 Å
SCOPe Domain Sequences for d4xbpd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xbpd1 b.1.1.1 (D:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev
Timeline for d4xbpd1: