SCOPe 2.05: Domain d1akqa_: 1akq A:

Lineage for d1akqa_ (1akq A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (10 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
   Uniprot P00323

8. Domain d1akqa_: 1akq A: [31159]
   complexed with fmn; mutant

Details for d1akqa_

PDB Entry: 1akq, 1.9 Å

PDB Description: d95a oxidized flavodoxin mutant from d. vulgaris

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1akqa_:

Sequence; same for both SEQRES and ATOM records:

>d1akqa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgassyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

Timeline for d1akqa_:

• d1akqa_ first appeared (with stable ids) in SCOP 1.55, called d1akq__
  
• d1akqa_ appears in SCOPe 2.04
  
• d1akqa_ appears in SCOPe 2.06
  
• d1akqa_ appears in the current release, SCOPe 2.08