SCOP 1.73: Domain d2fx2a_: 2fx2 A:

Lineage for d2fx2a_ (2fx2 A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (8 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (5 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (9 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)

8. Domain d2fx2a_: 2fx2 A: [31158]
   complexed with fmn

Details for d2fx2a_

PDB Entry: 2fx2, 1.9 Å

PDB Description: comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures

PDB Compounds: (A:) flavodoxin

SCOP Domain Sequences for d2fx2a_:

Sequence; same for both SEQRES and ATOM records:

>d2fx2a_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

Timeline for d2fx2a_:

• d2fx2a_ first appeared (with stable ids) in SCOP 1.55, called d2fx2__
  
• d2fx2a_ was called d2fx2__ in SCOP 1.71
  
• d2fx2a_ appears in SCOP 1.75
  
• d2fx2a_ appears in the current release, SCOPe 2.08