Lineage for d1akt__ (1akt -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68298Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 68299Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)
  6. 68300Protein Flavodoxin [52220] (6 species)
  7. 68340Species Desulfovibrio vulgaris [TaxId:881] [52222] (20 PDB entries)
  8. 68347Domain d1akt__: 1akt - [31157]

Details for d1akt__

PDB Entry: 1akt (more details), 1.8 Å

PDB Description: g61n oxidized flavodoxin mutant

SCOP Domain Sequences for d1akt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akt__ c.23.5.1 (-) Flavodoxin {Desulfovibrio vulgaris}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwn
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOP Domain Coordinates for d1akt__:

Click to download the PDB-style file with coordinates for d1akt__.
(The format of our PDB-style files is described here.)

Timeline for d1akt__: