SCOP 1.57: Domain d1bu5b_: 1bu5 B:

Lineage for d1bu5b_ (1bu5 B:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.5: Flavoproteins [52218] (3 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)

6. Protein Flavodoxin [52220] (6 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (20 PDB entries)

8. Domain d1bu5b_: 1bu5 B: [31156]

Details for d1bu5b_

PDB Entry: 1bu5, 1.83 Å

PDB Description: x-ray crystal structure of the desulfovibrio vulgaris (hildenborough) apoflavodoxin-riboflavin complex

SCOP Domain Sequences for d1bu5b_:

Sequence; same for both SEQRES and ATOM records:

>d1bu5b_ c.23.5.1 (B:) Flavodoxin {Desulfovibrio vulgaris}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

Timeline for d1bu5b_:

• d1bu5b_ first appeared (with stable ids) in SCOP 1.55
  
• d1bu5b_ appears in SCOP 1.59
  
• d1bu5b_ appears in the current release, SCOPe 2.08