Lineage for d2n4ia_ (2n4i A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761324Domain d2n4ia_: 2n4i A: [311558]
    automated match to d1py9a_

Details for d2n4ia_

PDB Entry: 2n4i (more details)

PDB Description: the solution structure of skint-1, a critical determinant of dendritic epidermal gamma-delta t cell selection
PDB Compounds: (A:) Selection and upkeep of intraepithelial T-cells protein 1

SCOPe Domain Sequences for d2n4ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n4ia_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mssepfivnglegpvlaslggnlelscqlsppqqaqhmeirwfrnlytepvhlyrdgkdm
fgeiiskyvertellkdgigegkvtlrifnvtvdddgsyhcvfkdgdfyeehitevkit

SCOPe Domain Coordinates for d2n4ia_:

Click to download the PDB-style file with coordinates for d2n4ia_.
(The format of our PDB-style files is described here.)

Timeline for d2n4ia_: