SCOPe 2.07: Domain d4s2bb_: 4s2b B:

Lineage for d4s2bb_ (4s2b B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (28 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [277890] (11 PDB entries)

8. Domain d4s2bb_: 4s2b B: [311556]
   automated match to d1i2na_
   complexed with 44s, so4

Details for d4s2bb_

PDB Entry: 4s2b, 1.46 Å

PDB Description: covalent complex of e. coli transaldolase talb with tagatose-6- phosphate

PDB Compounds: (B:) transaldolase b

SCOPe Domain Sequences for d4s2bb_:

Sequence; same for both SEQRES and ATOM records:

>d4s2bb_ c.1.10.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
tdkltslrqyttvvadtgdiaamklyqpqdattnpslilnaaqipeyrkliddavawakq
qsndraqqivdatdklavnigleilklvpgristevdarlsydteasiakakrliklynd
agisndriliklastwqgiraaeqlekegincnltllfsfaqaracaeagvflispyvgr
ildwykantdkkeyapaedpgvvsvseiyqyykehgyetvvmgasfrnigeilelagcdr
ltiaptllkelaesegaierklsytgevkarpariteseflwqhnqdpmavdklaegirk
faidqeklekmigdll

Timeline for d4s2bb_:

• d4s2bb_ first appeared in SCOPe 2.06
  
• d4s2bb_ appears in the current release, SCOPe 2.08