Lineage for d4s2bb_ (4s2b B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835105Species Escherichia coli [TaxId:83333] [277890] (11 PDB entries)
  8. 2835108Domain d4s2bb_: 4s2b B: [311556]
    automated match to d1i2na_
    complexed with 44s, so4

Details for d4s2bb_

PDB Entry: 4s2b (more details), 1.46 Å

PDB Description: covalent complex of e. coli transaldolase talb with tagatose-6- phosphate
PDB Compounds: (B:) transaldolase b

SCOPe Domain Sequences for d4s2bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s2bb_ c.1.10.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
tdkltslrqyttvvadtgdiaamklyqpqdattnpslilnaaqipeyrkliddavawakq
qsndraqqivdatdklavnigleilklvpgristevdarlsydteasiakakrliklynd
agisndriliklastwqgiraaeqlekegincnltllfsfaqaracaeagvflispyvgr
ildwykantdkkeyapaedpgvvsvseiyqyykehgyetvvmgasfrnigeilelagcdr
ltiaptllkelaesegaierklsytgevkarpariteseflwqhnqdpmavdklaegirk
faidqeklekmigdll

SCOPe Domain Coordinates for d4s2bb_:

Click to download the PDB-style file with coordinates for d4s2bb_.
(The format of our PDB-style files is described here.)

Timeline for d4s2bb_: