![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
![]() | Protein automated matches [190891] (38 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [188368] (2 PDB entries) |
![]() | Domain d4s2ua2: 4s2u A:163-309 [311553] automated match to d1dkra2 complexed with mg |
PDB Entry: 4s2u (more details), 2.71 Å
SCOPe Domain Sequences for d4s2ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s2ua2 c.61.1.0 (A:163-309) automated matches {Escherichia coli [TaxId: 562]} npivvspdiggvvraraiakllndtdmaiidkrrpranvsqvmhiigdvagrdcvlvddm idtggtlckaaealkergakrvfayathpifsgnaannlrnsvidevvvcdtiplsdeik slpnvrtltlsgmlaeairrisneesi
Timeline for d4s2ua2: