SCOPe 2.08: Domain d4s2ua2: 4s2u A:163-309

Lineage for d4s2ua2 (4s2u A:163-309)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188368] (2 PDB entries)

8. Domain d4s2ua2: 4s2u A:163-309 [311553]
   automated match to d1dkra2
   complexed with mg

Details for d4s2ua2

PDB Entry: 4s2u, 2.71 Å

PDB Description: crystal structure of the phosphorybosylpyrophosphate synthetase from e. coli

PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d4s2ua2:

Sequence; same for both SEQRES and ATOM records:

>d4s2ua2 c.61.1.0 (A:163-309) automated matches {Escherichia coli [TaxId: 562]}
npivvspdiggvvraraiakllndtdmaiidkrrpranvsqvmhiigdvagrdcvlvddm
idtggtlckaaealkergakrvfayathpifsgnaannlrnsvidevvvcdtiplsdeik
slpnvrtltlsgmlaeairrisneesi

Timeline for d4s2ua2:

• d4s2ua2 first appeared in SCOPe 2.06
  
• d4s2ua2 appears in SCOPe 2.07