Lineage for d4s2ua2 (4s2u A:163-309)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891948Species Escherichia coli [TaxId:562] [188368] (2 PDB entries)
  8. 2891954Domain d4s2ua2: 4s2u A:163-309 [311553]
    automated match to d1dkra2
    complexed with mg

Details for d4s2ua2

PDB Entry: 4s2u (more details), 2.71 Å

PDB Description: crystal structure of the phosphorybosylpyrophosphate synthetase from e. coli
PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d4s2ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s2ua2 c.61.1.0 (A:163-309) automated matches {Escherichia coli [TaxId: 562]}
npivvspdiggvvraraiakllndtdmaiidkrrpranvsqvmhiigdvagrdcvlvddm
idtggtlckaaealkergakrvfayathpifsgnaannlrnsvidevvvcdtiplsdeik
slpnvrtltlsgmlaeairrisneesi

SCOPe Domain Coordinates for d4s2ua2:

Click to download the PDB-style file with coordinates for d4s2ua2.
(The format of our PDB-style files is described here.)

Timeline for d4s2ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4s2ua1