Lineage for d4ww1a2 (4ww1 A:128-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2749924Domain d4ww1a2: 4ww1 A:128-217 [311551]
    Other proteins in same PDB: d4ww1a1, d4ww1b1, d4ww1b2
    automated match to d2pyfa2

Details for d4ww1a2

PDB Entry: 4ww1 (more details), 1.38 Å

PDB Description: crystal structure of human tcr alpha chain-trav21-traj8 and beta chain-trbv7-8
PDB Compounds: (A:) TCR Alpha Chain-TRAV21-TRAJ8

SCOPe Domain Sequences for d4ww1a2:

Sequence, based on SEQRES records: (download)

>d4ww1a2 b.1.1.2 (A:128-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records): (download)

>d4ww1a2 b.1.1.2 (A:128-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d4ww1a2:

Click to download the PDB-style file with coordinates for d4ww1a2.
(The format of our PDB-style files is described here.)

Timeline for d4ww1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ww1a1