Lineage for d3x3ha_ (3x3h A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901127Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
    automatically mapped to Pfam PF12697
  6. 2901128Protein Hydroxynitrile lyase [53586] (2 species)
  7. 2901129Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (10 PDB entries)
  8. 2901152Domain d3x3ha_: 3x3h A: [311546]
    automated match to d3rkta_
    mutant

Details for d3x3ha_

PDB Entry: 3x3h (more details), 2.88 Å

PDB Description: crystal structure of the manihot esculenta hydroxynitrile lyase (mehnl) 3kp (k176p, k199p, k224p) triple mutant
PDB Compounds: (A:) (S)-hydroxynitrile lyase

SCOPe Domain Sequences for d3x3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x3ha_ c.69.1.20 (A:) Hydroxynitrile lyase {Cassava (Manihot esculenta) [TaxId: 3983]}
mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
qnvlaqrpkftekgygsipkvyiwtdqdkiflpdfqrwqianyppdkvyqvqggdhklql
tkteevahilqevadaya

SCOPe Domain Coordinates for d3x3ha_:

Click to download the PDB-style file with coordinates for d3x3ha_.
(The format of our PDB-style files is described here.)

Timeline for d3x3ha_: