Lineage for d4wvzd1 (4wvz D:3-201)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404257Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 protein domains)
    Pfam PF05995, CDO_I
  6. 2404320Protein automated matches [191276] (3 species)
    not a true protein
  7. 2404323Species Pseudomonas aeruginosa [TaxId:1402521] [311540] (1 PDB entry)
  8. 2404327Domain d4wvzd1: 4wvz D:3-201 [311541]
    Other proteins in same PDB: d4wvzc2, d4wvzd2
    automated match to d4tlfd_
    complexed with fe2

Details for d4wvzd1

PDB Entry: 4wvz (more details), 2.09 Å

PDB Description: crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa
PDB Compounds: (D:) Thiol dioxygenase

SCOPe Domain Sequences for d4wvzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wvzd1 b.82.1.19 (D:3-201) automated matches {Pseudomonas aeruginosa [TaxId: 1402521]}
silrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqryqq
yllhvdsrqrfsvvsfvwgpgqitpvhdhrvwcligmlrgaeysqpyafdaggrphpsga
rrrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpfis
gysnsrlpniwdlskenpa

SCOPe Domain Coordinates for d4wvzd1:

Click to download the PDB-style file with coordinates for d4wvzd1.
(The format of our PDB-style files is described here.)

Timeline for d4wvzd1: