Lineage for d1azla_ (1azl A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2464624Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2464625Protein Flavodoxin [52220] (10 species)
  7. 2464661Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
    Uniprot P00323
  8. 2464668Domain d1azla_: 1azl A: [31154]
    complexed with fmn; mutant

Details for d1azla_

PDB Entry: 1azl (more details), 1.8 Å

PDB Description: g61v flavodoxin mutant from desulfovibrio vulgaris
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1azla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azla_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwv
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOPe Domain Coordinates for d1azla_:

Click to download the PDB-style file with coordinates for d1azla_.
(The format of our PDB-style files is described here.)

Timeline for d1azla_: