![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
![]() | Superfamily c.23.5: Flavoproteins [52218] (3 families) ![]() |
![]() | Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) |
![]() | Protein Flavodoxin [52220] (6 species) |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [52222] (15 PDB entries) |
![]() | Domain d1azl__: 1azl - [31154] |
PDB Entry: 1azl (more details), 1.8 Å
SCOP Domain Sequences for d1azl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azl__ c.23.5.1 (-) Flavodoxin {Desulfovibrio vulgaris} pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwv ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq dglridgdpraarddivgwahdvrgai
Timeline for d1azl__: