SCOPe 2.06: Domain d2n2za_: 2n2z A:

Lineage for d2n2za_ (2n2z A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.0: automated matches [254196] (1 protein)
   not a true family

6. Protein automated matches [254428] (6 species)
   not a true protein

7. Species Anethum graveolens [TaxId:40922] [311535] (1 PDB entry)

8. Domain d2n2za_: 2n2z A: [311536]
   automated match to d1fk5a_

Details for d2n2za_

PDB Entry: 2n2z

PDB Description: nmr spatial structure of nonspecific lipid transfer protein from the dill anethum graveolens l.

PDB Compounds: (A:) Non-specific lipid-transfer protein

SCOPe Domain Sequences for d2n2za_:

Sequence; same for both SEQRES and ATOM records:

>d2n2za_ a.52.1.0 (A:) automated matches {Anethum graveolens [TaxId: 40922]}
ltcgqvtgalapclgylrtagsvpvpltccngvrglnnaarttidrrtacnclkqtanai
adlnlnaaaglpakcgvnipykispstdcnrvv

Timeline for d2n2za_:

• d2n2za_ is new in SCOPe 2.06-stable
  
• d2n2za_ appears in SCOPe 2.07
  
• d2n2za_ appears in the current release, SCOPe 2.08