Lineage for d2n2za_ (2n2z A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714949Family a.52.1.0: automated matches [254196] (1 protein)
    not a true family
  6. 2714950Protein automated matches [254428] (8 species)
    not a true protein
  7. 2714954Species Anethum graveolens [TaxId:40922] [311535] (1 PDB entry)
  8. 2714955Domain d2n2za_: 2n2z A: [311536]
    automated match to d1fk5a_

Details for d2n2za_

PDB Entry: 2n2z (more details)

PDB Description: nmr spatial structure of nonspecific lipid transfer protein from the dill anethum graveolens l.
PDB Compounds: (A:) Non-specific lipid-transfer protein

SCOPe Domain Sequences for d2n2za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n2za_ a.52.1.0 (A:) automated matches {Anethum graveolens [TaxId: 40922]}
ltcgqvtgalapclgylrtagsvpvpltccngvrglnnaarttidrrtacnclkqtanai
adlnlnaaaglpakcgvnipykispstdcnrvv

SCOPe Domain Coordinates for d2n2za_:

Click to download the PDB-style file with coordinates for d2n2za_.
(The format of our PDB-style files is described here.)

Timeline for d2n2za_: